General Information

  • ID:  hor002162
  • Uniprot ID:  P10764
  • Protein name:  Insulin-like growth factor II
  • Gene name:  IGF2
  • Organism:  Ovis aries (Sheep)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005178 integrin binding; GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0000122 negative regulation of transcription by RNA polymerase II; GO:0001503 ossification; GO:0001701 in utero embryonic development; GO:0001892 embryonic placenta development; GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0051147 regulation of muscle cell differentiation; GO:0051148 negative regulation of muscle cell differentiation; GO:0051781 positive regulation of cell division; GO:0060669 embryonic placenta morphogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCAAPAKSE
  • Length:  67
  • Propeptide:  MGITAGKSMLALLAFLAFASCCYAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCAAPAKSERDVSASTTVLPDDFTAYPVGKFFQSDTWKQSTQRLRRGLPAFLRARRGRTLAKELEALREAKSHRPLIALPTQDPATHGGASSEASSD
  • Signal peptide:  MGITAGKSMLALLAFLAFASCCYA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver.
  • Mechanism:  The IGF2 locus is imprinted. Paternal inherited gene is expressed, while the maternal inherited gene is imprinted, hence silenced.
  • Cross BBB:  NA
  • Target:  IGF2R
  • Target Unid:  W5P3H8
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  9-47; 21-60; 46-51
  • Structure ID:  AF-P10764-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002162_AF2.pdbhor002162_ESM.pdb

Physical Information

Mass: 867988 Formula: C322H506N94O101S6
Absent amino acids: HMW Common amino acids: RS
pI: 6.34 Basic residues: 9
Polar residues: 25 Hydrophobic residues: 20
Hydrophobicity: -25.67 Boman Index: -15121
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 67.01
Instability Index: 8129.4 Extinction Coefficient cystines: 4845
Absorbance 280nm: 73.41

Literature

  • PubMed ID:  2537174
  • Title:  Sheep insulin-like growth factors I and II: sequences, activities and assays.